DeepGOWeb Protein Function prediction webserver


DeepGOWeb is a webserverice for predicting protein functions based on protein sequence using DeepGOPlus method. It uses deep convolutional neural networks to learn sequence features and combines predictions with sequence similarity based predictions.

The tool only needs protein sequence as an input. The source code of the model is available on GitHub repository

The REST API is available for submitting sequences programmatically.

We also provide a SPARQL endpoint for calling our predictor in SPARQL queries.

Input data:

  • Format: FASTA format or Raw Sequences separated by a newline
  • Threshold: a value between 0.1 and 1.0 for filtering predictions by the confidence score of the model
  • Data: Protein sequences in selected format


The number of sequences in one query should not exceed 10!

Examples:

>sp|P80386|AAKB1_RAT 5'-AMP-activated protein kinase subunit beta-1 OS=Rattus norvegicus GN=Prkab1 PE=1 SV=4 MGNTSSERAALERQAGHKTPRRDSSGGTKDGDRPKILMDSPEDADIFHTEEMKAPEKEEF LAWQHDLEVNEKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSQNNFVAILDLPE GEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELS SSPPGPYHQEPYISKPEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLY ALSIKDGVMVLSATHRYKKKYVTTLLYKPI


MPYKLKKEKEPPKVAKCTAKPSSSGKDGGGENTEEAQPQPQPQPQPQAQSQPPSSNKRPSNSTPPPTQLSKIKYSGGPQIVKKERRQSSSRFNLSKNRELQKLPALKDSPTQEREELFIQKLRQCCVLFDFVSDPLSDLKFKEVKRAGLNEMVEYITHSRDVVTEAIYPEAVTMFSVNLFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLALLDLFDSEDPRERDFLKTILHRIYGKFLGLRAYIRRQINHIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKMFLIRVLLPLHKVKSLSVYHPQLAYCVVQFLEKESSLTEPVIVGLLKFWPKTHSPKEVMFLNELEEILDVIEPSEFSKVMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAARVLPIMFPALYRNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEAL